SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026868 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026868
Domain Number 1 Region: 102-295
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.92e-60
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000265
Further Details:      
 
Domain Number 2 Region: 317-418
Classification Level Classification E-value
Superfamily EPT/RTPC-like 0.0000000163
Family RNA 3'-terminal phosphate cyclase, RPTC 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026868   Gene: ENSSSCG00000021809   Transcript: ENSSSCT00000030942
Sequence length 489
Comment pep:novel scaffold:Sscrofa10.2:JH118586.1:25163:77557:-1 gene:ENSSSCG00000021809 transcript:ENSSSCT00000030942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGPSTPKSPGASNFSTLPKISP
SSLSNNYNNINNRNVKNSNYCLPSYTAYKNYDYSEPGRNNEQPGLCGLSNLGNTCFMNSA
IQCLSNTPPLTEYFLNDKYQEELNFDNPLGMRGEIAKSYAELIKQMWSGKFSYVTPRAFK
TQVGRFAPQFSGYQQQDCQELLAFLLDGLHEDLNRIRKKPYIQLKDADGRPDKVVAEEAW
ENHLKRNDSIIVDIFHGLFKSTLVCPECAKISVTFDPFCYLTLPLPMKKERTLEVYLVRM
DPLTKPMQYKVVVPKIGNILDLCTALSTLSGVPADKMIVTDIYNHRFHRIFAMDENLSSI
MERDDIYVFEININRTEDTEHVIIPVCLREKFRHSSYTHHTGSSLFGQPFLMAVPRNNTE
DKLYNLLLVRMCRYVKISTETEETEGSLHCCKDQNINGNGPNGIHEEGSPSKTSQLNCKN
VSLGVLLQR
Download sequence
Identical sequences ENSSSCP00000026868 ENSSSCP00000026868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]