SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026906 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026906
Domain Number 1 Region: 39-179
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.91e-46
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00026
Further Details:      
 
Domain Number 2 Region: 153-243
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000168
Family Laminin G-like module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026906   Gene: ENSSSCG00000021551   Transcript: ENSSSCT00000032493
Sequence length 244
Comment pep:novel chromosome:Sscrofa10.2:6:11143433:11358986:-1 gene:ENSSSCG00000021551 transcript:ENSSSCT00000032493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSVTGAVLKMLLLLSTPNWNRVLAGNSYDCDAPLVSALSQASFSSSSELSSSHGPGFAR
LNRRDGAGGWSPLVSNKYQWLQIDLGERMEITSVATQGGYGSSNWVTSYLLMFSDSGRNW
KQYRQEDSIWGFAGNANADSVVYCRLQPSIKARFLRFIPLEWNPKGRIGMRIEVFGCAYR
SEVVDLDGKSSLLYRFDQKSLSPIKDIISLKFKTTQSYGVLLHWEGLNGDHITLELRRGK
LYFL
Download sequence
Identical sequences ENSSSCP00000026906 ENSSSCP00000026906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]