SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026943 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026943
Domain Number 1 Region: 365-414
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.00000124
Family Transglutaminase core 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026943   Gene: ENSSSCG00000027007   Transcript: ENSSSCT00000031445
Sequence length 661
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:90319065:90337712:1 gene:ENSSSCG00000027007 transcript:ENSSSCT00000031445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLPPEKASELKQLIHQQLSKMDVHGRIREILAETIREELAPDQQQLSTEDLIKALRRRG
IVDDVMKELNFVPDNVDQELPSSPKQPVCFTDRQSTLLKKTNIDPTRRYLYLQVLGGKAF
LEHLQEPEPLPGQPCSTFTLCLHFRNQRFRSKPVPCACEPDFHDGFLLEVHRENLGDGTR
MADSTTMLSISDPVHMVLIKTDIFAETTLVASYFLEWRSVLGSENGVTNLTVELMGVGTE
SKVSVGILNIKLEMYPPLNQTLSQEVVNTQLALERQKTAEKERLFLVYAKQWWREYLQIR
PSHNSRLVKIFAQDENGINRPVCSYVKPLRAGRLLDTPRQAARFVNVLGYERAPVIGGGG
KQEQWCTLLAFLCRNKGDCEDHANLLCSLLLGYGLEAFVCVGTKAKGVPHAWVMTCGTDG
TITFWESLTGHRYIHKPTNPDEPPAAEQPKPLYPYKTVGCVFNHQMFLGNCQPSDSVESC
VFDLNDESKWKPMSEEAIKSVCAPGATTSLPPFPPLCASTIDASVTSNEIEMQLRLLVSE
HRKDLGLTTVWEDQLSYLLSPALAAYEFERTTSISAGNEEFQDAIRRAVPDGHTFKGFPI
HFVYRNARRAFATCLRSPFCEEIICCRGDQVRLAVRVRVFTYPESACAVWIMFACKYRSV
L
Download sequence
Identical sequences ENSSSCP00000026943 ENSSSCP00000026943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]