SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000027015 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000027015
Domain Number 1 Region: 15-217
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.02e-53
Family SPRY domain 0.00000000722
Further Details:      
 
Domain Number 2 Region: 222-262
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000131
Family SOCS box-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000027015   Gene: ENSSSCG00000025460   Transcript: ENSSSCT00000028618
Sequence length 263
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:66272196:66278391:1 gene:ENSSSCG00000025460 transcript:ENSSSCT00000028618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQTALAGGSSSTPTPQPLYPDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVK
EGGLCFERRPVAQSTDGVRGKRGYSRGLHAWEISWPREQRGTHAVVGVATALAPLQADHY
AALLGSNSESWGWDIGRGKLYHQSKGPGAPRYPPGLQGEHLEVPERLLVVLDMEEGTLGY
AIGGTYLGPAFRGLKGRTLYPAVSAVWGQCHVRISYLGERRAEPHSLLHLSRLCVRHALG
ATRLGYVSALPLPPAMKRYLLYQ
Download sequence
Identical sequences F1SLT6
9823.ENSSSCP00000000731 ENSSSCP00000027015 ENSSSCP00000027015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]