SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000027064 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000027064
Domain Number 1 Region: 276-378
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.21e-17
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000027064   Gene: ENSSSCG00000028572   Transcript: ENSSSCT00000027190
Sequence length 1116
Comment pep:known_by_projection scaffold:Sscrofa10.2:GL893685.1:34090:91114:-1 gene:ENSSSCG00000028572 transcript:ENSSSCT00000027190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNPRGNQRPELEGPQASGPEALGKDSAEMWHQKHQLQGKYTETSHRQCEFRDRVFEELIT
VVQEMKTHFPSARHSKPSTLDALNYALRCVHSVQANSEFFQSLRQNNGAPQADVTVYRPE
ELATIASEHASKNTDTFVAVFSFLSGRLVHISEQAPSVLNCRKELLESSPFAELLAPQDV
GVFYSHTAHAQLPFWNNWTQRASPHDLAPVKSFFCRIRSGGDAGKPERLYGPFRIVPYLI
HLHSPARPEPEPCCLLLLNHNGNSAPRIPENKRVFTTTHTPGCVFLEIDERAVPLLGYLP
QDLIGTSILTHLHPEDAALMLAVHQKVLKLAGQPPFDHSPIRFCSQNGDYIILDSSWSSF
VNPWSRKISLIIGQHQVRTSPLNEDVFATRIKKMNSNDKDITELQEQIHKLLLQPVRGGS
PADGGCGSLGSSGSPEHPVSLASSSGSSGRCEEEPRAASTLQQVHASVDKVKTPGQQLYS
ESMTKSPKKQVTGTRTAGPGGESGEQEAFSSFQTLKNDRMCTESCEDLETDQHSPSYQQI
NCIDSVIRFLKSHDMPALKRKCRSYTNTASSSSGEDGPNPGAAASRIPATPASGVPATGW
PIDAVGGAPGPVDTTALDLDVSQSSDCSTIVHILPPESGSVEVGTSPATPPQHQSAEDFK
HRGLTEAVPSAHMQKEEQSYVDKFREKVPSSPYSLCLQQENGGKTKYAHGQGDPAPPPTR
SAGCKKGKPRRKKLLLLSDSKGAEDSICPPLRPEVQAGQPWCPASASLAAAVMVPSPAPY
MFPALSLPAVTSVGGEGAASGPAPPGPPEPPVPRGSWSLPALPSACLDPFMNLFLHDPPV
CALLSPSFASDPFLGAPGTSELPPSVSALAADLDAASSFISERPGEEKWGAQSEAHPLGL
SGASSPLQLSLLRGDRPRSGEASGPVRSDVCLEAERQCVGGPSGNKNSYFTASDLPTVSL
HKTSPPETGSAATGSSHSNIDFASSDSSSEITPGGQQSQDEQRKETFPGLADDSIWRMIE
QTPECVLMTYQVPKRVKEIVLREDLEKLGSMRRRQPHFSHGQRKELAAVYAWIQSQTVPQ
ERDTQRSCVPCGNKDSAGEAGAATESRGRDPAGDGN
Download sequence
Identical sequences ENSSSCP00000027064 ENSSSCP00000027064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]