SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000027099 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000027099
Domain Number 1 Region: 1-172
Classification Level Classification E-value
Superfamily ALDH-like 7.98e-62
Family ALDH-like 0.0000000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000027099   Gene: ENSSSCG00000023356   Transcript: ENSSSCT00000024465
Sequence length 173
Comment pep:novel chromosome:Sscrofa10.2:1:126147027:126172480:-1 gene:ENSSSCG00000023356 transcript:ENSSSCT00000024465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDASERGHLLDKLADLVERDRAILATMESLNGGKPFLQAFYVDLQGVIKTLRYYAGWADK
IHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTP
LSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHVGIDKIAFTGSTEVGA
Download sequence
Identical sequences ENSSSCP00000027099 ENSSSCP00000027099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]