SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000027107 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000027107
Domain Number - Region: 22-75
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0823
Family Laminin G-like module 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000027107   Gene: ENSSSCG00000025914   Transcript: ENSSSCT00000031195
Sequence length 132
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:108955285:108996278:1 gene:ENSSSCG00000025914 transcript:ENSSSCT00000031195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKQKIPFKYNRPVEEWLQEKGRQLTIFNTQAQIAIGGKDKGRLFQGQLSGLYYDGLKVL
NMAAENNPNIKINGSVRLVGEVPSILGTTQTTSMPPEMSTTVMETTTTMATTTTRKNRST
ASIQVSLSLIIH
Download sequence
Identical sequences ENSSSCP00000027107 ENSSSCP00000027107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]