SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000027121 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000027121
Domain Number 1 Region: 25-260
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.38e-80
Family Eukaryotic proteases 0.00000000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000027121   Gene: ENSSSCG00000024668   Transcript: ENSSSCT00000025379
Sequence length 263
Comment pep:known chromosome:Sscrofa10.2:6:51469507:51475249:-1 gene:ENSSSCG00000024668 transcript:ENSSSCT00000025379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWFLVLRLALSLAGTGAAPPIQSRIIGGRECEKDSHPWQVAIYHYSSFQCGGVLVDPKWV
LTAAHCKNDNYQVWLGRHNLFENEDTAQFFGVTADFPHPGFNLSLLKNHTKADGKDYSHD
LMLLRLQSPAKITDAVKVLELPTQEPELGSTCQASGWGSIEPGPDDFEFPDEIQCVELTL
LQNTFCADAHPDKVTESMLCAGYLPGGKDTCMGDSGGPLICNGMWQGITSWGHTPCGSAN
KPSIYTKLIFYLDWINDTITENP
Download sequence
Identical sequences A0A287BI78
ENSSSCP00000027121 ENSSSCP00000027121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]