SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000027142 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000027142
Domain Number 1 Region: 8-92
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.00000000903
Family DPP6 N-terminal domain-like 0.00000417
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000027142   Gene: ENSSSCG00000022007   Transcript: ENSSSCT00000022423
Sequence length 97
Comment pep:novel chromosome:Sscrofa10.2:18:3482384:3565479:-1 gene:ENSSSCG00000022007 transcript:ENSSSCT00000022423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CFLCLFQIYQHSYTGYYVLSKIPHGDPQSLDPPEVSNAELQYAGWGPKGQQLIFIFENNI
YYCAHVGKQAIRVVSTGKEGVIYNGLSDWLYEGMRDT
Download sequence
Identical sequences ENSSSCP00000027142 ENSSSCP00000027142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]