SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000027178 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000027178
Domain Number 1 Region: 582-825
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.04e-81
Family Eukaryotic proteases 0.0000484
Further Details:      
 
Domain Number 2 Region: 88-217
Classification Level Classification E-value
Superfamily SEA domain 1.07e-22
Family SEA domain 0.0076
Further Details:      
 
Domain Number 3 Region: 232-345
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000222
Family Spermadhesin, CUB domain 0.0037
Further Details:      
 
Domain Number 4 Region: 351-462
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000458
Family Spermadhesin, CUB domain 0.0038
Further Details:      
 
Domain Number 5 Region: 467-505
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000733
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 544-583
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000183
Family LDL receptor-like module 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000027178
Domain Number - Region: 503-539
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000209
Family LDL receptor-like module 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000027178   Gene: ENSSSCG00000025721   Transcript: ENSSSCT00000024472
Sequence length 829
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:157329924:157369343:1 gene:ENSSSCG00000025721 transcript:ENSSSCT00000024472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKENSDVSSKPADVNISNISVQVVSAQGKLAGRRPPRKLVSKAKPKKPPKKKVPFWNVQ
NKIILLTVFLFILAVVAWTLLWLYISKTESRDAFYFVGMFRVTNIEFLPEYRQKESREFL
SVARTVQQVVNLVYTTSAFSKFYKQSVVADVSSNNKGGLLVHFWLVFVMPHAKGHVFCED
CVAAILKDSIQTSIVNRTSVGSLQGLAVDMDSVVLNAGLRSDYSSTIGSDKGCSQYFYAD
HLSLRYPLEISTTSGRLMCHFKLVAVVGHLIRLSIESVQIEADNCVTDSLTIYDSLLPIR
STILYRICEPTRTLMSFVSTNNLMLVTFKSPQVRRLSGIRAYFEVIPEQKCENTLLVKEI
TGFEGKISSPYYPSYYPPKCKCTWKFQTPLPTLGIALKFHNYSITKKSVKGCDHGWWEIN
EHMYCGSYVDHQTIFRVPSPLVHIQLQCSSRLSDKPLLAEYGSYNISQPCPVGSFRCSSG
LCVPQAQRCDGVNDCFDESDELFCVTLKPACNVSSFRQQGPLVCDGFRDCEDGQDEQNCT
QSIPCNHRTSKCGNDICIRKQNAGCDGAVDCPDGSDEEGCSCSRSSSTLHRIIGGTDTQE
GGWPWQVSLHFVGSAYCGASVISREWLLSAAHCFHGNRLSDPTPWTAHLGMYVQGNAKFV
SPVRRIVVHEYYNSQTFDYDIALLQLSIAWPETLKQLIQPICIPPAGQKVRSGEKCWVTG
WGRKHEADNKGSPVLQQAEVELIDQTVCVSTYGIITSRMLCAGVMSGKKDACRGDSGGPL
SCRRKSDGKWILTGIVSWGHGCGRPNFPGVYTRVSNFVPWIHKYVPSLL
Download sequence
Identical sequences I3LST5
ENSSSCP00000027178 XP_013837916.1.46622 ENSSSCP00000027178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]