SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000027279 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000027279
Domain Number 1 Region: 16-372
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.73e-70
Family L-arabinose binding protein-like 0.0011
Further Details:      
 
Domain Number 2 Region: 392-506,625-765
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.61e-66
Family Phosphate binding protein-like 0.00000000106
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000027279
Domain Number - Region: 516-620
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000902
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000027279   Gene: ENSSSCG00000025119   Transcript: ENSSSCT00000028121
Sequence length 896
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:203411536:203632118:-1 gene:ENSSSCG00000025119 transcript:ENSSSCT00000028121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGIFETVENEPVNVEELAFKFAVTSINRNRTLMPNTTLTYDIQRINLFDSFEASRRACDQ
LALGVAALFGPSHSSSVSAVQSICNALEVPHIQTRWKHPSVDNKDLFYINLYPDYAAISR
AVLDLVLYYNWKTVTVVYEDSTGLIRLQELIKAPSRYNIKIKIRQLPSGNKDAKPLLKEM
KKGKEFYVIFDCSHETAAEILKQILFMGMMTEYYHYFFTTLDLFALDLELYRYSGVNMTG
FRLLNIDNPHVSSIIDKWSMERLQAPPRPETGLLDGMMTTEAALMYDAVYMVAIASHRAS
QLTVSSLQCHRHKPWRLGPRFMNLIKEAQWDGLTGRITFNKTDGLRKDFDLDIISLKEEG
TEKIGIWNSNSGLNMTDGNKDRSNNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDR
FEGYCLDLLKELSNILGFIYDVKLVPDGKYGAQNDKGEWNGMVKELIDHKADLAVAPLTI
TYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLF
VIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGI
WWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKI
STYEKMWAFMSSRQQTALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLI
DSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEDNKEASALGVEN
IGGIFIVLAAGLVLSVFVAIGEFIYKSRKNNDIEQQKGKSSRIRFYFRNKVRFHGRKKQS
LGVEKCLSFNAIMEELGISLKNQKKLKKKSRTKGKSSFTSILTCHQRRTQKKETVA
Download sequence
Identical sequences ENSSSCP00000027279 ENSSSCP00000027279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]