SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000027282 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000027282
Domain Number 1 Region: 1244-1304
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000000136
Family BSTI 0.052
Further Details:      
 
Domain Number 2 Region: 1626-1685
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000164
Family ATI-like 0.018
Further Details:      
 
Domain Number 3 Region: 441-501
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000213
Family ATI-like 0.028
Further Details:      
 
Domain Number 4 Region: 862-918
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000425
Family ATI-like 0.056
Further Details:      
 
Domain Number 5 Region: 53-104
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000018
Family ATI-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000027282   Gene: ENSSSCG00000027515   Transcript: ENSSSCT00000027766
Sequence length 1914
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:44123697:44154834:1 gene:ENSSSCG00000027515 transcript:ENSSSCT00000027766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVVRDCVYDLCLLPGQSGPLCDALASYAAACQAAEATVYPWRNEELCRMTARPHSHYEEC
SYGCPMSCGDLPVLGGCGYNCKEGCVCDEGFVLDGESCVPLASCGCVYQGAYHPPGQTFH
PGPGCDSLCHCEEGGLVSCEPSSCGPHEACQPSSGVLGCVAVGSATCQASGDPHYTTFDG
RRFDFMGTCVYALARTCGTRPGLAQFAVLQENVAWGNGKVSVTKAITVQVANFTLRLEQN
QRKVTVNGVDVRLPVVLANGQVHAFQHGSDVVIETDFGLRVAYDLQYNVRVTVPGNYYQQ
LCGLCGNYNDNPKDDFQKPDGSQAGSPNEFGNSWEERVPDSPCLPPPTCAPGGDCEPEPE
CKPELEEKYKQEKFCGLLTSSTGPLAACHKLLDPQGPLQDCVFDLCLGGGNESILCSNIH
AYVSACQAAGGQVEPWRTESFCPMACHPNSHYELCADTCSWGCSALSAPPQCPETCAEGC
QCDSGFLNDGKGCVPIQECGCYHNGVYYEPEQTVLIDNCQQQCVCHAGKGMACQDHSCEP
GQVCQPSEGVLSCITKDPCHGVTCRPQETCKEKDGQGVCVPNYEATCWLWGDPHYHSFDG
WNFDFQGTCNYVLASTSCPGISAQGLTAFTVTTKNENRGNPAVSFVRLVTVTTLNTNISI
HKGEIGKVRVNGVLTALPVSEAGGRLSVTHGASKAVLATDFGLQVSYDWDWRVEVTLPSS
YHGAVCGLCGNMDRNPSNDQAFPNGTLAPSIPIWGGSWRVPGWDPLCWDECQGSCPTCSE
DNLEKYEGPSFCGPLVPGTGGPFADCHAQVAPESFFKGCVLDVCLGGGAQDILCQALAAY
AAACQAAGVVIKDWRTQAGCEMSCPDNSHYELCGPPCPASCPSPAPPTTPAPCEGPCAEG
CQCNSGFVWSASHCVPLDGGCGCWANGTYHEAGSEFWADATCSQRCQCGPGGGSLVCKPA
SCGLGEECALLPSGQHGCHPISTVECQAWGDPHYITLDGHRFDFQGSCEYLLSAPCQGPP
AGVENFNVTVENEHRGSQAVSYTRTVTLHIYGHSFTLSARWPRQLQVDGKLVALPFQLDT
RLHAYVSGPVVVTTTSGISLAFDGDSNVRLAVPAAYGALCGLCGNYNPDPKDDLNAWAET
QLLASGPCRGLPGDACPGPCPEPCTPEQQEPSGGPDACGVISAPDGPLSPCHSLVPPAQY
FQACLLDACQAQGHPEGLCPAVAAYVAACQAAGAQLDEWRRPDFCPLQCPAHSHYKLCGD
SCPVSCPSLSAPEGCEPTCREGCVCDAGFVLSGDTCVPVGQCGCLHEGRYYPLGEAFYPG
PECGRRCECGPGGQVTCQEGAACRPYEECRLQDGVQACYPIGCGRCLANGGTHYITLDGR
VYDLHGSCSYILAQVCHPQPGDEDFAIVLEKNAAGDPQRLVVTVADQVVSLAPGPQVTVD
GEAVALPVAVGHVRVTAEGRNVILQTTKDLRLLFDGDAHILISIPSPFHGRVCGLCGNFN
GNWSDDFVLPSGAVAPSVDAFGAAWRVPGSSQSCSEGCGPAGCPVCLAEETAPYESLNAC
GRLRDPNGPFSACHAVLGPSEYFRQCVYDLCAHKGNSTFLCRSLAAYTAACQAAGSAVKP
WRTDSFCPLQCPAHSHYSVCTRSCQGSCAALGLTGCTTRCFEGCECDDRYLLSQGICIPV
QDCGCSHDGRYLPANSSLLTPDCSKRYSCSSSTGLTCQEVSCPPGRICEIQAGAWDCWVP
QGLCSLSVDANLTTFDGARSAVHSPGVYELSHRCPGLREAIPWYRVVADVQPCSGKAEAV
GLVHLFFQDGLVTVTRKKGVWVNGLQVSLPAEVLTSVFVHRNPDGSVLVQQKAGVRVRLG
TDGQLAVMVSDEHAGMLCGACGNFDADQTNDGLGSQGKATLEDWRAQDFSPCLN
Download sequence
Identical sequences ENSSSCP00000027282 ENSSSCP00000027282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]