SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000027360 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000027360
Domain Number 1 Region: 456-707
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.56e-60
Family Eukaryotic proteases 0.0000404
Further Details:      
 
Domain Number 2 Region: 365-457
Classification Level Classification E-value
Superfamily Kringle-like 5.07e-33
Family Kringle modules 0.0001
Further Details:      
 
Domain Number 3 Region: 277-362
Classification Level Classification E-value
Superfamily Kringle-like 5.32e-30
Family Kringle modules 0.00021
Further Details:      
 
Domain Number 4 Region: 185-241
Classification Level Classification E-value
Superfamily Kringle-like 4.59e-16
Family Kringle modules 0.00071
Further Details:      
 
Domain Number 5 Region: 144-180
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000991
Family Kringle modules 0.0032
Further Details:      
 
Domain Number 6 Region: 20-101
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000000000247
Family Hairpin loop containing domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000027360   Gene: ENSSSCG00000029588   Transcript: ENSSSCT00000024652
Sequence length 709
Comment pep:novel scaffold:Sscrofa10.2:JH118746.1:61431:66505:-1 gene:ENSSSCG00000029588 transcript:ENSSSCT00000024652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWLPLLLLLTQCSGAPGQRSPLNDFQVLPGTELQHLLHAVGPGSWQEDVADAEECAGRC
GPLMDCRNVSSHGCQLLPWTQHSPHTRLQHSGSFDLFQKKRLGREVLRSQALLILGLLLS
DYXGFPMTTSKTECRSPFSRRPGLRNGLEENFCRNPDRDPGGPWCYTMDPAVRFQSCRVS
GSRSTVCFWCNGEDYRGSVDRTESGRECQRWDLQHPHPHPFEPLKFLDKNLDDNYCRNRC
GRAQGRGWEGTWDTWGAWPGWEVSIQGSGAQPRQEATTLNCFRGKGEGYRGMVNTTAAGV
PCQRWDAQHPHQHRFAPEKYACKDLRENFCRNPDGSEAPWCFTSRPGMRVAFCYQIRRCN
DDVRPEDCYHGWGEQYRGSVSKTRKGVRCQSWSARTPHKPQFTPTSDPEAQLEENFCRNP
DGDSHGPWCYTTDPGIPFDYCALRRCDDDQPPSILEPPDPVLFEKCGKRVTRVDPRRSKL
RVVGGQPGNSPWTVSLRNRQGQHFCGGSLVKEQWVLTARQCFSSCHVPLMGYEVWLGTLF
QNPQPGEPGLQRIPVAKMICGPSDSQLVLLKLERPATLNQRVALICLPPERYVVPPGTKC
EIAGWGETKGTGDDTVLNMASLNVISNQECNVKHRGRVRESEMCTEGLLAPVGACEGDYG
GPLACFTHDCWVLEGIIIPNRVCARPRWPAIFMRVSVFVDWINKVMRLG
Download sequence
Identical sequences ENSSSCP00000027360 ENSSSCP00000027360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]