SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000027446 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000027446
Domain Number 1 Region: 103-275
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 3.77e-47
Family NadC C-terminal domain-like 0.0000372
Further Details:      
 
Domain Number 2 Region: 23-102
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 3.37e-21
Family NadC N-terminal domain-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000027446   Gene: ENSSSCG00000028405   Transcript: ENSSSCT00000030842
Sequence length 289
Comment pep:novel scaffold:Sscrofa10.2:GL893865.2:10375:12483:1 gene:ENSSSCG00000028405 transcript:ENSSSCT00000030842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSLPGLALLLPPATLATLANPVALVTGAAPSQAVLWAKSPGVLAGRPFFDAIFAQVNCQV
SWFLPEGSKLVPVAKVAEVQGPAHCLLLGERVALNMLARCSGVASAAATAVETARGTGWA
GHVAGTRKTTPGFRLVEKYGLLVGGATSHRYDLGGLVMVKDNHVVALGNPQKWRGQGARR
AANFALKVEVECSSLQEALEAAEAGADLVLLDNFRPEELHPTAAALKAQFPTVGVEASGG
VTLDNLPQFCGPHIDVISLGMLTQAAPALDFSLKLFAEGTTPVPYARKS
Download sequence
Identical sequences ENSSSCP00000027446 ENSSSCP00000027446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]