SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000027582 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000027582
Domain Number 1 Region: 32-271
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.23e-71
Family Alanine racemase-like, N-terminal domain 0.000000000722
Further Details:      
 
Domain Number 2 Region: 255-405
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 2.3e-49
Family Eukaryotic ODC-like 0.00000033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000027582   Gene: ENSSSCG00000027121   Transcript: ENSSSCT00000031422
Sequence length 449
Comment pep:known_by_projection scaffold:Sscrofa10.2:GL894404.1:6996:13088:-1 gene:ENSSSCG00000027121 transcript:ENSSSCT00000031422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLEXGFTAKDILDQKINEVSATDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCND
SRTIVQTLAAIGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQIKYAANNGVQMMT
FDSEVELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLKTSRLLLERARDLDIDVI
GVSFHVGSGCTDPETFAQAISDARCVFDMGAEVGFSMYLLDIGGGFPGSEDVKLKFEEIT
GVINPALDKYFPPDSGVRIIAEPGRYYVASAFTLAVNIIAKKLVLKEQTGSDDEEEASEQ
TFMYYVNDGVYGSFNCILYDHAHVQPLLQKRPKPDEKYYSSSIWGPTCDGLDRIVERCRL
PEMHVGDWMLFENMGAYTVAAASTFNGFQRPAIYYVMSGPTWQLMQQIRNHDFPPEVGEQ
DVGPLPVSCAWESGMERHPAACASARINV
Download sequence
Identical sequences ENSSSCP00000027582 ENSSSCP00000027582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]