SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000027635 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000027635
Domain Number 1 Region: 166-446,538-656
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.87e-72
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00094
Further Details:      
 
Domain Number 2 Region: 11-72
Classification Level Classification E-value
Superfamily UBA-like 2.17e-26
Family UBA domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000027635   Gene: ENSSSCG00000024623   Transcript: ENSSSCT00000022689
Sequence length 1069
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:190890292:191009147:1 gene:ENSSSCG00000024623 transcript:ENSSSCT00000022689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILFLSLNRIGSRNHQQTFLNQLREITGINDAQILQQALKDSNGNLELAVAFLTAKNAKT
PQQEETAYYQTALPGNDRYISVGSQADTNVIDLTGDDKDDLQRAIALSLAESNRAFRETG
ITDEEQAISRVLEASIAENKACLKRTPTEVWRDSRNPYDRKRQDKAPVGLKNVGNTCWFS
AVIQSLFNLLEFRRLVLNYKPPSNAQDLPRNQKEHRNLPFMRELRYLFALLVGTKRKYVD
PSRAVEILKDAFKSNDSQQQDVSEFTHKLLDWLEDAFQMKAEEETDEEKPKNPMVELFYG
RFLAVGVLEGKKFENTEMFGQYPLQVNGFKDLHECLEAAMIEGEIESLHSENSGKSGQEH
WFTELPPVLTFELSRFEFNQALGRPEKIHNKLEFPQVLYLDRYMHRNREITRIKREEIKR
LKDYLTVLQQRLERYLSYGSGPKRFPLVDVLQYALEFASSKPVCTSPVDDIDASSPSSGS
IPSQTLPRYYMHQPFICENTTELPSTSPASIAAISSRSVIHKPFTQSRIPPDLPMHPAPR
HITEEELSVLESCLHRWRTEIENDTRDLQESISRIHRTIELMYSDKSMIQVPYRLHAVLV
HEGQANAGHYWAYIFDHRENRWMKYNDIAVTKSSWEELVRDSFGGYRNASAYCLMYINDK
PQFLIQEEFNKETGQALVGIETLPPDLRDFVEEDNQRFEKELEEWDAQLAQKALQEKLLA
SQKLRESESSMTTASLSCEFCSRNEEAQAGEPEYLEQPSRSDFSKHLKEETIRIITKASH
EHEDKSPETVLQSAIKLEYSRLVKLAQEDTPPETDYRLHHVVVYFIQNQAPKKIIEKTLL
EQFADRNLSFDERCHNIMKVAQAKIEMIKPEEVNLAQLQEWHQDYRKFRETTMYLIIGLE
NFQRESYIDSLLFLICAYQNNKELLSKGPHRGHDEELISHYRRECLLKLNEQAAELFESG
EDREVNNGLIIMNEFIVPFLPLLLVDEMEEKDILAVEDMRNRWCSYLGQEMESNLQEKLT
DFLPKLLDCSTEIKGFHEPPKLPPYSTHELCERFTRIMLSLSRTPADGR
Download sequence
Identical sequences ENSSSCP00000027635 ENSSSCP00000020389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]