SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000027650 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000027650
Domain Number 1 Region: 212-393
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-32
Family SPRY domain 0.013
Further Details:      
 
Domain Number 2 Region: 2-40
Classification Level Classification E-value
Superfamily SAP domain 0.0000000139
Family SAP domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000027650   Gene: ENSSSCG00000030049   Transcript: ENSSSCT00000025796
Sequence length 865
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:45075622:45111110:1 gene:ENSSSCG00000030049 transcript:ENSSSCT00000025796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVRRLKVNELREELQRRGLDTLGLKAELAERLQAALEAEEPDDERELEADDEPGRPGHN
SEEVETEGGSELEGTAQPPPPGLQLQPHPEPGGYSGPDGHYVMDNITRQNQFYETPVIKQ
ENESGYERRPLEMEQQQQAYRPVEVKTEMKQEAPTSFLPPEASQLKPDRQQFQSRKRPYE
ENRGRGYFEHREERRGRSPQPPAEEDEDDFDDTLVAIDTYNCDLHFKVARDRSSGYPLTI
EGFAYLWSGARASYGVRRGRVCFEMKINEEISVKHLPSTEPDPHVVRIGWSLDSCSTQLG
EEPFSYGYGGTGKKSTNSRFENYGDKFAENDVIGCFVDFECGNDVELSFTKNGKWMGIAF
RIQKEALGGQALYPHVLVKNCAVEFNFGQRAEPYCSVLPGFTFIQHLPLSERIRGTVGPK
SKAECEIFLLLSSLPHGHQQVGVLPGCSVKLSLLHSIPXRNYILDQKSRILMGLPRQRLI
FSEWKLLVVTALRCVLEHRSVPAPAQDAPNHHLEETNVYGSAQRRKMRPFEGFQRKAIVI
CPTDEDLKDRTIKRTDEEGKDVPDHAVLEMKANFTLPDVGDFLDEVLFIELQREEADKLV
RQYNEEGRKAGPPPEKRFDNRGGGGFRGRGGGGGFQRYDNRGPPGGSRGGFQNRGGGSGG
GGNYRGGFNRSGGGGYNQNRWGNNSRDNNNSNNRGSYNRAPQQQPPPQQPPPPQPPPQQP
PPPPSYSPARNPPGASSYNKNSNIPGSSANTSTPTVSSYSPPQPSYSQPPYNQGGYSQGY
TAPPPPPPPPPAYNYGSYGGYNPAPYTPPPPPTAQTYPQPSYNQYQQYAQQWNQYYQNQG
QWTPYYGNYDYGSYSGNTQGGTSTQ
Download sequence
Identical sequences ENSSSCP00000027650 ENSSSCP00000027650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]