SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000027678 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000027678
Domain Number 1 Region: 1-111
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.43e-28
Family MAM domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000027678   Gene: ENSSSCG00000030655   Transcript: ENSSSCT00000030492
Sequence length 133
Comment pep:novel chromosome:Sscrofa10.2:1:249900221:249907040:-1 gene:ENSSSCG00000030655 transcript:ENSSSCT00000030492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYIEASHMVYGQKAQLLSRPLRGVAGRHCLTFFYHMYGAGTGLLNVYLKKEGDTEEPLLW
RRRGEQSISWLKALIEYSCERQHQIIFEAIRGVSIRSDIAIDDIKFQAGPCSELEDITQQ
SSGYSEDLNEIEY
Download sequence
Identical sequences NP_001231912.1.46622 ENSSSCP00000027678 ENSSSCP00000027678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]