SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000027702 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000027702
Domain Number - Region: 49-72
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00255
Family Pan module (APPLE domain) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000027702   Gene: ENSSSCG00000029717   Transcript: ENSSSCT00000030209
Sequence length 116
Comment pep:known chromosome:Sscrofa10.2:15:54178972:54191258:1 gene:ENSSSCG00000029717 transcript:ENSSSCT00000030209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVIVLFRIISFRQAVYFMCLFAAVSCGCLPQLHKNTFFRGGDVSAMYTPSARHCQMMCT
FHPRCLLFSFLPADSTSVTDKRFGCFLKDSVTGMLPRVLRKNAISGHSLKQCGHQI
Download sequence
Identical sequences ENSSSCP00000027702 ENSSSCP00000027702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]