SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000027862 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000027862
Domain Number 1 Region: 225-422
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-28
Family SPRY domain 0.014
Further Details:      
 
Domain Number 2 Region: 454-604
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000155
Family Nucleotide and nucleoside kinases 0.043
Further Details:      
 
Domain Number 3 Region: 2-39
Classification Level Classification E-value
Superfamily SAP domain 0.0000000641
Family SAP domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000027862   Gene: ENSSSCG00000028542   Transcript: ENSSSCT00000030161
Sequence length 747
Comment pep:novel chromosome:Sscrofa10.2:2:8380470:8391746:1 gene:ENSSSCG00000028542 transcript:ENSSSCT00000030161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVKRLKVTELRSELQRRGLDSRGLKVDLAQRLQEALDAEMLEDEAGGGGAGPGGACKAE
PRPVAASGGGPGGDEEEDEEEEEEDEEALLEDEDEEPPPAQASDEAAQPPPEPPEAAATE
AVAESDASEKPAEEATAGSGGVNGGEEQGTVKGEEEEPEERSGDETPGSEAPADKAAEEQ
GDDQDSEKSKPAGSDGERRGVKRQRDEKDEHGRAYYEFREEAYHSRSKSPPPPEEEAKDE
EEDQTLVNLDTYTSDLHFQVSKDRYGGQPLFSEKFPTLWSGARSTYGVTKGKVCFEAKVT
QNLPMKEGCTEVSLLRVGWSVDFSHPQLGEDEFSYGFDGRGLKAENGQFEEFGQTFGEND
VIGCFANFEAEEVELSFSKNGEDLGVAFRISKESLADRALLPHVLCKNCVVELNFGQKEE
PFFPPPEEFVFIHAVPVEERVRTAVPPKTIEECEVILMVGLPGSGKTQWALKYAKENAEK
RYNVLGAETVLNQMRMKGLEEPEMDPKSRDLLVQQASQCLSKLVQIASRTKRNFILDQCN
VYNSGQRRKLLLFKTFSRKVVVVVPNEEDWKKRLELRKEVEGDDVPESIMLEMKANFSLP
EKCDYMDEVTYGELEKEEAQPIVTKYKEEARKLLPPSEKRTNRRNNRNKRNRQNRSRGQG
YVGGQRRGYDNRAYGQQYWGQSGNRGGYRNFYDRYRGDYDRFYGRDYEYNRYRDYYRQYN
RDWQNYYYHPQDRDRYYRNYYGYQGYR
Download sequence
Identical sequences ENSSSCP00000027862 ENSSSCP00000027862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]