SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000027879 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000027879
Domain Number 1 Region: 3-243
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.18e-71
Family Eukaryotic proteases 0.0000006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000027879   Gene: ENSSSCG00000024003   Transcript: ENSSSCT00000031040
Sequence length 255
Comment pep:known chromosome:Sscrofa10.2:7:79789592:79792159:-1 gene:ENSSSCG00000024003 transcript:ENSSSCT00000031040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPLLLLVALLLPPGARAGEIIGGQEARPHSRPYMAYMHFQSAQGQKTCGGFLVRKDFVM
TAAHCFGRQTVVILGAHNIRRFERTQQRISVLRAIPHPRYNPYNHLNDIMLLQLANRTRQ
NRFVRPVALPRTQARLSPGARCTVAGWGLVSLSRRTDTLQEVQLTVQRDGECHRRFDHYN
GRIQMCVGDPRERKSAFLGDSGGPLVCGRVAQGIVSYGNRQGTPPAVFTRVSSFLPWIRR
TMSRFQQRGQAEIPL
Download sequence
Identical sequences A0A287BDI2
9823.ENSSSCP00000002163 ENSSSCP00000020175 ENSSSCP00000027879 ENSSSCP00000020175 ENSSSCP00000027879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]