SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000027978 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000027978
Domain Number 1 Region: 334-507
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.64e-16
Family Clostridium neurotoxins, the second last domain 0.076
Further Details:      
 
Domain Number 2 Region: 176-253
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000134
Family Cadherin 0.013
Further Details:      
 
Domain Number 3 Region: 74-188
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000314
Family Cadherin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000027978   Gene: ENSSSCG00000025489   Transcript: ENSSSCT00000028598
Sequence length 846
Comment pep:novel scaffold:Sscrofa10.2:GL894246.2:47741:76238:1 gene:ENSSSCG00000025489 transcript:ENSSSCT00000028598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKETSASWLTCGQGGLPLRHPRRDCWSFFSGEGSPGCAAGWRPPYPHPRQGGCWLEWAS
VRKKANKHKPWIEAEYQGIVMENDNTVLLNPPLFALDKDAPLRYAGNRLGPDLRPGGSVR
LALWEAGVGTGCLKMNAFPHDCEAQKEHTFTIQAYDCGEGPDGANTKKSHKATVHVRVND
VNEFAPVFVERRYHAAVTEGKLYDRILXCYYEILTPNTPFLIDNDGNIENTEKLQYSGEK
LYKFTVXAADDAEVEIQVKPTCKPSWQGWNKRIEYAPGAGSLALFPGIRLETCDEPLWNI
QATIELQTSHVAKGCDRDNYSERALRKLCGAAPGEVDLLPMPGPNANWTAGLYSSLIYWF
NGTQAVQVPLGGTAGLGSGPQDSLSDHLSLSFWMKHGVTPNKGKKEEETIVCNTVQNEDG
FSHYSLTVHGCRIAFLYWPLLESARPVKFLWKLEQVCDDEWHHYALNLEFPTVTLYADGI
SFDPALIHDNGLIHPPRREPALMIGACWAEEKNKEKEKGGDNSTDATPGDPLPIHHYFHG
YLAGFSVRWGVFYKFDLCKSRPHLRPVVEWKNHELGMRGMECCTECPPFFLSLLGEELCR
FIHFCKNIGYKGGDVGVPSCLSPLFSCRCFSEESCVSIPEVEGYVVVLQPDAPQILLSGT
AHFARPAVDFEGPEGVPLFPDLQITCSISHQVEAKKDESWQGTVTDTRMSDEIVHNLDGC
EISLVGDDLDPERESLLLDMASLQQRGLELTNTSAYLTIAGVESIKARYRLRHGAALYAR
KFRLSCSEMNGRYSSNEFVVEVSVLHSMNRVAHPSHMLSSQKFLHRGHQPPPEMAGHSLA
SSHRNS
Download sequence
Identical sequences ENSSSCP00000027978 ENSSSCP00000027978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]