SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000027979 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000027979
Domain Number 1 Region: 1323-1486
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.52e-28
Family Laminin G-like module 0.0025
Further Details:      
 
Domain Number 2 Region: 1493-1666
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.2e-23
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 3 Region: 1092-1262
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.76e-22
Family Laminin G-like module 0.0073
Further Details:      
 
Domain Number 4 Region: 925-1094
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.24e-21
Family Laminin G-like module 0.0029
Further Details:      
 
Domain Number 5 Region: 723-915
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000143
Family Laminin G-like module 0.0097
Further Details:      
 
Domain Number 6 Region: 78-120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000105
Family Laminin-type module 0.0055
Further Details:      
 
Domain Number 7 Region: 130-180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000586
Family Laminin-type module 0.066
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000027979
Domain Number - Region: 254-470
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00366
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000027979   Gene: ENSSSCG00000003709   Transcript: ENSSSCT00000024191
Sequence length 1668
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:101420993:101498019:-1 gene:ENSSSCG00000003709 transcript:ENSSSCT00000024191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAAVRQSAWSARWLWLFGVALGPCLGYSSQQQRVVFPQLPAQNQLQTSYVESKPSQGCS
PGYYRDNKGFYTGRCVPCNCHGHSNRCKDGSGICINCQHNTAGEHCERCKEGYYGNAIHG
SCQACLCPHSNSFATGCIVTGGNMRCLCKPGYTGTLCERCAPGYFGNPQKFGGSCQPCNC
NSNGQLVSCDPLTGDCMNQEPKDSGPGEECDDCDSCVMTLLNDLATMDDELRLVKSQLQG
LSVSSRTLEQMRHLETQTKDLRNQLLNYRSTISSQESKMDGLEEELSNLNLEFEAFQEKV
QINSRKAQTLYNVVDRAIQSAEELNTKIKNAIYNVHMLNRIRSWLEKHQVENNGLVKNIQ
DALNEYEAKLSDLRTTMQEASAQAKRAAGLNRDNERALESITKQVKEMKSLQSDFTKHLT
TAEASLMQTNTVLQLMRKIHEEYKKTAATLNEARQELSDKVRELSKSSSKEPLVEEAEKH
SQSLQALAKQLEEIKRNTSGDELVRCAVDAATAYENILNAITAAEDAADKAARASESALQ
TVIKEDLPRKAKTLSSGSHKLLNEAKRTQTKLQQEISPALSNLQQTLKIMTVQKGMINTN
LTTIRNDLRGIQRDDISGIISSAKTLVRNANDITNEVLDGLSPIQTDVERIKDTYGSTQR
EDFNQALTDADNSVRKLTNKLPDVLSKIESINQQLLPLGNISDNVDRIRELIQQARDAAN
KVAIPMRFNGKSGVEVRLPNDLEDLKGYTSLSLFLQRPESAEHGSTENMFVMYLGNKDAS
RDYIGMAVVDGQLMCVYNLGEQEAELQVDQTLTKSETQEAVMDRVKFQRIYQFARLNYTQ
KATSSKPEAPQLHDVDSKSSNTLLNLDPENVVFYVGGYPSDFRLPSRLRFPPYKGCIELD
DLNENVLSLYNFKKTFNLNTTEVEPCRRRKDESDKNYFEGTGYARIPTQSNAANPFFTQI
IQTTVDSGLLFFAENQDCFMSLNIEGGRLMVRYKVDSGPPKEKEIGAIVNDGKDHLISVR
ISRLQKRMRIRMDSLSSIEGDAFDFSTYYLGGIPISIRERFNISTPAFRGCMKNLRKTSG
VVRLNDTVGVTKRCSEDWKLVRSASFSRGGQLSFTNLDWPSPSHFQASFGFQTFQPSGIL
LNHQTRSSSLQVTLEDGHIELSTRDSSGPILTSPQTYMDGLLHYVSVISDNSGLRLLIDD
QPLKNNQKLRDFSDSQQSLRLGGSQFEGCISNVFVRRLMESPKVLDLASKSTKRDVSLGG
CSLNKPPFLMLLKGSTKFNKAKTFDIHQPLRDTAAASSRSLKVWGDAQSCPPSPGAKASH
GALRFGDSPTSHLLFILPQELPKPRSQFAVDVQTTSSRGLVFYTGTKTSFMALYLSKGRL
VFALGAEGKKLKLKSKERCNDGKWHTVVFGHDGERGRLVMDGLRAREGSLPGNSTISLRA
PVYLGASPSGKSKSLPQNSFVGCLRNFQLDLKPLETPSASLGVSPCLGGSLEKGIYFSQE
GGHVILANSVFLGPEFKLVFSIRPRSLTGILIHIGSQPGEHLCVYLEAGKVTASVSSEAG
GILTSVTPKQSLCDGQWHSVAVTIKQHIVHLELDSEHSYTAGRHPFSPARTKEHLHIGDV
PGNSCADFPPTRGCVGGLLKIQVNHVPIPVTEATQVQGTVSLNGCPDH
Download sequence
Identical sequences ENSSSCP00000027979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]