SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000028008 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000028008
Domain Number 1 Region: 33-66
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.00000000549
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000028008   Gene: ENSSSCG00000029580   Transcript: ENSSSCT00000023114
Sequence length 66
Comment pep:novel chromosome:Sscrofa10.2:15:148070122:148070319:-1 gene:ENSSSCG00000029580 transcript:ENSSSCT00000023114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGDLFEEDYSSVSNNHYGKGKKLKTKTLEPSAPREFTNLSGIRNQGGTCYLNSLLQTLH
FTPEFR
Download sequence
Identical sequences ENSSSCP00000028008 ENSSSCP00000028008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]