SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000028088 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000028088
Domain Number 1 Region: 9-204
Classification Level Classification E-value
Superfamily PRTase-like 5.25e-45
Family Phosphoribosyltransferases (PRTases) 0.00049
Further Details:      
 
Domain Number 2 Region: 237-478
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.05e-36
Family Decarboxylase 0.0000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000028088   Gene: ENSSSCG00000011864   Transcript: ENSSSCT00000027472
Sequence length 481
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:145114836:145154892:-1 gene:ENSSSCG00000011864 transcript:ENSSSCT00000027472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAADVALASLVTGLYDVQAFKFGSFVLKSGLSSPVYIDLRGIVSRPRLLSQVAEILFQT
AQNAGINFDTVCGVPYTALPLATVICSTNQIPMLIRRKEAKDYGTKRLIEGAVNPGETCL
IIEDVVTSGSSILETVEVLQKEGLKVTDAIVVLDREQGGRDKLQAHGIRLHSVCTLSNML
EILEQQKKIDAEMVERVKRFIQENVFVVANHNGSLPSAKKAPKELSFGTRAELPGIHPVA
SKLLRLMQKKETNLCLSADISESRELLQLADALGPSICMLKTHVDILNDFTPDVMKELTT
LAKRHEFLIFEDRKFADIGNTVKKQYAGGTVACPLVGGGINVKMVTGGELKSFYSAILSP
SSELSFLIPELSVTQCIASSTVPCASQGLSCRHCPGFNIGNICITTLSSKKLWIHKTKRY
KRETVGDNLGQQYNSPQEVIGKRGSDIIIVGRGILMSANRLEAAEKYRKAAWEAYLSRLA
V
Download sequence
Identical sequences ENSSSCP00000028088 ENSSSCP00000012636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]