SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000028117 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000028117
Domain Number 1 Region: 6-162
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-32
Family YWTD domain 0.0000484
Further Details:      
 
Domain Number 2 Region: 166-206,259-348
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000847
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 305-437
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000377
Family Growth factor receptor domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000028117   Gene: ENSSSCG00000027559   Transcript: ENSSSCT00000032398
Sequence length 481
Comment pep:known_by_projection scaffold:Sscrofa10.2:GL896369.1:2390:26704:-1 gene:ENSSSCG00000027559 transcript:ENSSSCT00000032398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSLIEGSDLNGKYREIIIKEDISQPRGIAVHPVAKRLFWTDMGTNPRIESSSLQGIGRQV
IASSDLVWPSGITIDYLTDKLYWCDAKQSVIEMSNLDGSRRQRLAQNDVGHPFAVAVFED
HVWFSDWTMPSVIRVNKRTGKNRVRLRGSMLKPSSLVVVHPLAKPGTNPCLHQNGGCEHI
CKESFGTAQCLCHEGFLKAPDGKMCLALNGQEILAGRGKDLSDGVMPVDTLPRSRELEDN
LTESQHILVAEIMVSDDEDCGAAGCSAQARCVTEGEDATCQCLKGFAGDGNLCSDIDECE
LGTSVCPPTSSECINTEGGHVCRCSEGYQGDGIHCLDIDECQLGVHTCGENATCTNTEGN
YTCTCAGRPSEPGRICPDPTPPSHLGEDGRYSVVDSYACNGPHDGFRLHHNTLMLLQRIM
EYSCFCVFGYVGERCQHRDLKWWELRHAGLGRQWNVTVVAVCVVVLVLLLLLGLWGAHYY
R
Download sequence
Identical sequences ENSSSCP00000028117 ENSSSCP00000028117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]