SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000028134 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000028134
Domain Number 1 Region: 74-290
Classification Level Classification E-value
Superfamily FKBP-like 2.16e-28
Family FKBP immunophilin/proline isomerase 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000028134   Gene: ENSSSCG00000030439   Transcript: ENSSSCT00000031937
Sequence length 368
Comment pep:novel scaffold:Sscrofa10.2:JH118743.1:1450:30183:-1 gene:ENSSSCG00000030439 transcript:ENSSSCT00000031937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGASDEDDTDFLSPSGGARLASLFGPDQAVAGHGNEFFQYTAPKQPKKGQGTVSTGNQV
TPKTAPTTTGTSTVLVAIAVHAYRYTNGQYVKQGKFGAAVLGNHTAREYRILLYISQQQP
VTVARIHLNFELMVRPNNYSTFYDDQRQNWSIMFESEKAAVEFNKQVCIAKCNSTSSLDS
VLSQDLVVTEGPAVEVGDSLEVAYTSWVFQNHTLGQVLDSTANKDKLLRLKLGSGKVIKG
WEDGMVGMKKGAKRLLFIPPACAAGSEGVIGWSHSTDSILVFEVEIRRVKFARDAGSDGH
SVSSRDSAAPSPVPGVDNISADPVVSPSTSVPFKSGESALRSKSNSLSEQLTMNTVSIHI
CLLIPSLL
Download sequence
Identical sequences ENSSSCP00000028134 ENSSSCP00000028134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]