SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000028139 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000028139
Domain Number 1 Region: 174-305
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000011
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 4-116
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000282
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 362-495
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000957
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 4 Region: 112-155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000217
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 5 Region: 337-373
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000031
Family EGF-type module 0.005
Further Details:      
 
Domain Number 6 Region: 296-339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000927
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000028139
Domain Number - Region: 156-181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0356
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000028139   Gene: ENSSSCG00000022819   Transcript: ENSSSCT00000031447
Sequence length 504
Comment pep:known_by_projection scaffold:Sscrofa10.2:GL893511.2:242611:266746:1 gene:ENSSSCG00000022819 transcript:ENSSSCT00000031447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTC
LCMPGFKGVHCELEINECQSNPCVNSGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTP
CLNGAKCIDHPNGYECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSYTCICNPGYM
GAICSDQIDECYSSPCLNEGRCIDLVNGYQCNCQPGTSGVNCEINFDDCASNPCVHGVCV
DGVNRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINDVNGFRCMCPEGPHHPSCYSQ
VNECLSNPCIHGNCTGGLSGYKCLCDAGWVGINCEVDKNECLSDPCQNGGTCDNLVNGYR
CTCKKGFKGHNCQVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGKNCQTVLAPCSPN
PCENAAVCKEAPNFESYTCLCAPGWQGQRCSVDIDECISKPCMNHGLCHNTQGSYMCECP
PGFSGMDCEEDIDDCLASEYSSQL
Download sequence
Identical sequences ENSSSCP00000028139 ENSSSCP00000028139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]