SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000028153 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000028153
Domain Number 1 Region: 28-66
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000439
Family Growth factor receptor domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000028153   Gene: ENSSSCG00000025982   Transcript: ENSSSCT00000031903
Sequence length 330
Comment pep:known_by_projection scaffold:Sscrofa10.2:GL894073.2:12415:24664:1 gene:ENSSSCG00000025982 transcript:ENSSSCT00000031903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFSPAPTAMAFTPAPLEDTSARPQVCKWPCECPPSPPRCPLGVSLITDGCECCKMCAQQL
GDNCXGPEAAPHFLRSSCIQILTPFPLLHPGGISMADSRKEKAKQNTIVLGGSVTLPPLC
FPISPPPLRGPRLCHSXVPGRCCEQWVCDDDARRPRKTAPRHTGAFGEPGQRKGWRREAS
WVTPPWPQHTTTCGLGVSTRISSVNPRCWPEQESRLCNLRPCDVDLRPRIKEGKTCLAVY
QPEAPVNFTLAGCTSTRSYRPKYCGVCTDGRCCIPYKSKTIDVSFRCPDGPGFSRRALWI
NACFCNLSCRNPNDIFADLDSYPEFSEMAN
Download sequence
Identical sequences ENSSSCP00000028153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]