SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000028227 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000028227
Domain Number - Region: 80-120
Classification Level Classification E-value
Superfamily LysM domain 0.00497
Family LysM domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000028227   Gene: ENSSSCG00000030487   Transcript: ENSSSCT00000025768
Sequence length 297
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:154771010:154777360:1 gene:ENSSSCG00000030487 transcript:ENSSSCT00000025768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQKGVLTKTFRGPASVCRTPTSHVYMFENGSGDSGDSSEEESHRVALRPRGKERQKKGA
HQSHQPGAGDVVLLQRELAQEDSLNTLALQYGCKVADIKKVNNFIREQDLYALKSIKIPV
KNHGILTETCKELRPLLSSSTETRVTFEEQPDPDRVAVGANAPSSPLTEFFKGIDQNIEH
AVQSEIFLSESYCLGTSSQPLLPAPPKTSTSGADCGIQWWNAVFIMLLIGIVLPVFYLVY
FKIQATSEIPSSLNTTAVPNGSMIMSAVPEQAPKLVIPGPTIPSSDSQFSQTIHRGN
Download sequence
Identical sequences F1SRX4
9823.ENSSSCP00000005189 ENSSSCP00000028227 ENSSSCP00000028227 XP_005659840.1.46622 XP_013848682.1.46622 XP_013848683.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]