SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000028239 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000028239
Domain Number 1 Region: 3-286
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.81e-94
Family Autophagin-like 0.000000000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000028239   Gene: ENSSSCG00000012569   Transcript: ENSSSCT00000033291
Sequence length 325
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:103044907:103071239:1 gene:ENSSSCG00000012569 transcript:ENSSSCT00000033291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XKSKLLADISARLWFTYRRKFSPIDWNWEKQKEQPKEYQRILQCFLDRKDCCYSIHQMAQ
MGVGEGKSIGEWFGPNTVAQVLKKLALFDEWNSLAVYVSMDNTVVIEDIKKMCCASALSA
DAAVESRRDSLNASTQSKGPSACRPAWKPLLLIVPLRLGINQINPVYVDAFKECFKMPQS
LGALGGKPNNAYYFIGFLGDELIFLDPHTTQTFVDTEENGMVDDQTFHCLQPPQRMNILN
LDPSVALGFFCQEEKDFDSWCSLVQKEILKENLRMFELVQKHPPHWPPFVPPAKPEVTTT
GAEFIDSTEHLEEFDLEEDFEILSI
Download sequence
Identical sequences ENSSSCP00000028239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]