SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000028322 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000028322
Domain Number 1 Region: 35-300
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.83e-58
Family Eukaryotic proteases 0.0000802
Further Details:      
 
Domain Number 2 Region: 2-49
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000488
Family Complement control module/SCR domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000028322   Gene: ENSSSCG00000002749   Transcript: ENSSSCT00000035383
Sequence length 301
Comment pep:novel chromosome:Sscrofa10.2:6:14643497:14648220:1 gene:ENSSSCG00000002749 transcript:ENSSSCT00000035383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRYHCQTYYKLRTAGDGVYTLDSNKQWTNKVTGEKLPECEAVCGKPKNPVDQVQRIMGG
SLDAKGSFPWQAKMISHHNLTSGATLINEQWLLTTAKNLRLGHKNDTKAKDIAPTLRLYV
GKKQEVEIEKVIFHPDNSTVDIGLIKLKQKVPVNERVMPICLPSKDYVNVGLVGYVSGWG
RNANLNFTEHLKYVMLPVADQEKCVQYYEGSTVPEKKTPKSPVGVQPILNEHTFCAGLSK
YQEDTCYGDAGSAFAVHDKDDDTWYAAGILSFDKSCRTAEYGVYVRVTSILDWIQTTIAD
N
Download sequence
Identical sequences XP_005664416.1.46622 ENSSSCP00000028322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]