SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000028358 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000028358
Domain Number 1 Region: 97-180
Classification Level Classification E-value
Superfamily Immunoglobulin 1.15e-20
Family I set domains 0.000012
Further Details:      
 
Domain Number 2 Region: 186-287
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-18
Family I set domains 0.00000303
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000028358   Gene: ENSSSCG00000010698   Transcript: ENSSSCT00000033270
Sequence length 292
Comment pep:novel chromosome:Sscrofa10.2:14:142500502:142570248:-1 gene:ENSSSCG00000010698 transcript:ENSSSCT00000033270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLTSTWRYGRGRGIGSVTMVSWGRFICLVVVTMATLSLARPSFNLVEDTTVEPEDAISS
GDDEDDTDGSEDFVSENSNSKRAPYWTNTEKMEKRLHAVPAANTVKFRCPAGGSPTPTMR
WLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENDYGSINHTYHLDVVE
RSPHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLK
VLKHSGINSSNAEVLALFNVTEADAGEYICKVSNYIGQANQSAWLTVLPKQQ
Download sequence
Identical sequences ENSSSCP00000028358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]