SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000028375 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000028375
Domain Number 1 Region: 1-378
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 5.18e-152
Family Phosphoglycerate kinase 0.00000000000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000028375   Gene: ENSSSCG00000012440   Transcript: ENSSSCT00000034653
Sequence length 379
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:71339755:71351768:-1 gene:ENSSSCG00000012440 transcript:ENSSSCT00000034653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RIKAAIPSIKFCLDNGAKSVVLMSHLGRPDGIPMPDKYSLEPVAVELKSLLGKDVLFLKD
CVGPEVEKACADPAAGSVILLENLRFHVEEEGKGKDASGSKVKADPAKIEAFRASLSKLG
DVYVNDAFGTAHRAHSSMVGVNLPKKAGGFLMKKELNYFAKALESPERPFLAILGGAKVA
DKIQLINNMLDKVNEMIIGGGMAFTFLKVLNNMEIGTSLFDEEGSKIVKDLMSKAEKNGV
KITLPVDFVTADKFDENAKIGQATVASGIPAGWMGLDCGPESSKKYSEAVARAKQIVWNG
PVGVFEWEAFAQGTKALMDEVVKATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGA
SLELLEGKVLPGVDALSNV
Download sequence
Identical sequences ENSSSCP00000028375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]