SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000028376 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000028376
Domain Number - Region: 129-171
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.00491
Family Papain-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000028376   Gene: ENSSSCG00000009817   Transcript: ENSSSCT00000033214
Sequence length 263
Comment pep:known chromosome:Sscrofa10.2:14:33282668:33340371:-1 gene:ENSSSCG00000009817 transcript:ENSSSCT00000033214 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MPAWCSWNDVFQYETNKVTRIQSMNYGTIKWFFHVLVFSYVSFALVSDKRYQRKESVISS
VHTKVKGIAEVTQEIVENGLKKVVPSVLDTADYTFPLQGNSFFVMTNFLKTEGQEQGLCP
EYPTRRTLCSSNQGCKKGWMDPQSKGIQTGRCVEYKGKQKTCEVSAWCPIEAVEEAPQPA
LLRSAENFTVLIKNNIDFPGHNYTTYAKYYKENNVEKRTLIKVFGIRFDILVFGTGGKFD
IIQLIVYIGSTLSYFGLVRDSLS
Download sequence
Identical sequences ENSSSCP00000028376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]