SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000028385 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000028385
Domain Number 1 Region: 22-345
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.2e-111
Family Transferrin 0.000000224
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000028385   Gene: ENSSSCG00000030778   Transcript: ENSSSCT00000035987
Sequence length 345
Comment pep:novel chromosome:Sscrofa10.2:13:142726244:142739401:1 gene:ENSSSCG00000030778 transcript:ENSSSCT00000035987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGPNVALWLCLALRTALGGMEVRWCTISDPEQQKCSDMSKAFQEAGIQPSLLCVQGTSA
DHCVQLITAREADAITLDGGAIYEAGKEHSLKPVVGEVYDQEVGTSYYAVAVVKRGSRVT
INTLKGMKSCHTGINRTVGWNVPVGYLVESGRLSVMGCDVLKAVSDYFGGSCVPGAGDTS
YSESLCRLCRGNTAGEGVCDKSPLERYYDYSGAFRCLAEGAGDVAFVKHSTVLENTDGKT
LPSWGQALLSQDFELLCRDGSRADVTEWRRCHLARVPSHAVVVRADTDGGLIFRLLNEGQ
RLFSHEGSSFQMFSSDAYGQKNLLFKDATSELVPIATQTYEAWLG
Download sequence
Identical sequences ENSSSCP00000028385 ENSSSCP00000028385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]