SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000028497 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000028497
Domain Number 1 Region: 29-408
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 9.03e-55
Family L-arabinose binding protein-like 0.01
Further Details:      
 
Domain Number 2 Region: 417-588
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.04e-33
Family Phosphate binding protein-like 0.00000348
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000028497   Gene: ENSSSCG00000012638   Transcript: ENSSSCT00000036560
Sequence length 625
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:115591953:115802942:1 gene:ENSSSCG00000012638 transcript:ENSSSCT00000036560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARQKKMGQSVLQAVFFLVLGLLGHSHGGFPNTISIGGLFMRNTVQEHSAFRFAVQLYNT
NQNTTEKPFHLNYHVDHLDSSNSFSVTNAFCSQFSRGVYAIFGFYDQMSMNTLTSFCGAL
HTSFVTPSFPTDADVQFVIQMRPALKGAILSLLGHYKWEKFVYLYDTERGFSILQAIMEA
AVQNNWQVTARSVGNIKDVQEFRRIIEEMDRRQEKRYLIDCEVERINTILEQVVILGKHS
RGYHYMLANLGFTDILLERVMHGGANITGFQIVNNENPMVQQFIQRWVRLDEREFPEAKN
APLKYTSALTHDAILVIAEAFRYLRRQRVDVSRRGSAGDCLANPAVPWSQGIDIERALKM
VQVQGMTGNIQFDTYGRRTNYTIDVYEMKVTGSRKAGYWNEYERFVPFSDQQISNDSASA
ENRTIVVTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVGDGKY
GARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKS
KPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHLEDNNEEPRDPQSPPDPP
NEFGIFNSLWFSLGAFMQQGCDISP
Download sequence
Identical sequences ENSSSCP00000028497 ENSSSCP00000029798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]