SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000028526 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000028526
Domain Number 1 Region: 20-105
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 2.43e-17
Family Hairpin loop containing domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000028526   Gene: ENSSSCG00000011386   Transcript: ENSSSCT00000035727
Sequence length 196
Comment pep:known chromosome:Sscrofa10.2:13:35396501:35399075:-1 gene:ENSSSCG00000011386 transcript:ENSSSCT00000035727 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MGWLPLLLLLTQCSGAPGQRSPLNDFQVLPGTELQHLLHAVGPGSWQEDVADAEECAGRC
GPLMDCRAFHYNVSSHGCQLLPWTQHSPHTRLQHSGSFDLFQKKSTRPHSGTAWRRTSAA
TRTGTLEVPGATPWTLPCASRAAVSSPARRPFAFGCMARITAAQWIAPSQDASVSAGTCS
TRTRTHLSPSSSSTKI
Download sequence
Identical sequences ENSSSCP00000028526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]