SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000028625 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000028625
Domain Number 1 Region: 11-141
Classification Level Classification E-value
Superfamily ApaG-like 9.94e-42
Family ApaG-like 0.00021
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000028625
Domain Number - Region: 152-182
Classification Level Classification E-value
Superfamily ARM repeat 0.00403
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000028625   Gene: ENSSSCG00000013308   Transcript: ENSSSCT00000032939
Sequence length 202
Comment pep:novel chromosome:Sscrofa10.2:2:29800887:29811361:-1 gene:ENSSSCG00000013308 transcript:ENSSSCT00000032939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XYVHDPDCVATTGDITVSVSTSFLPELSSVHPPHYFFTYRIRIEMSKDALPEKACQLDSR
YWRITNAKGDVEEVQGPGVVGEFPIISPGRVYEYTSCTTFSTTSGYMEGYYTFHFLYFKD
KIFNVAIPRFHMACPTFRVSIARLEMGPDEYEEMEEEEEEEEDDEDDDDSADMDESDEDD
EEERRRRVFDVPIRRRRCSRLF
Download sequence
Identical sequences ENSSSCP00000028625 ENSSSCP00000028625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]