SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000028676 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000028676
Domain Number 1 Region: 360-461
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.91e-17
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000028676   Gene: ENSSSCG00000017983   Transcript: ENSSSCT00000032848
Sequence length 1277
Comment pep:known_by_projection chromosome:Sscrofa10.2:12:55836920:55847809:-1 gene:ENSSSCG00000017983 transcript:ENSSSCT00000032848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGPLEGADGGGDPRPGESFCPGGAPSPGPPQHRPCPGPSLADDTDANSNGSSGNESNGP
ESRGASQRSSHSSSSGNGKDSALLETTESSKSTNSQSPSPPSSSIAYSLLSASSEQDNPS
TSGCSSEQSARARTQKELMTALRELKLRLPPERRGKGRSGTLATLQYALACVKQVQANQE
YYQQWSLEEGEPCAMDMSTYTLEELEHITSEYTLRNQDTFSVAVSFLTGRIVYISEQAGV
LLRCKRDVFRGARFSELLAPQDVGIFYGSTAPSRLPTWGTGASAGSVLRDFAQEKSVFCR
IRGGPDRDPGPRYQPFRLTPYVTKIRVSDGAPAQPCCLLIAERIHSGYEAPRIPPDKRVF
TTRHTPSCLFQDVDERAAPLLGYLPQDLLGAPVLLFLHPEDRPLMLAIHKKILQLAGQPF
DHSPIRFCARNGEYVTMDTSWAGFVHPWSRKVAFVLGRHKVRTAPLNEDVFTPPAPSPTL
ALDTDIQELSEQIQRLLLQPVHSPSPTGLCGVGPATSPGPLLSPGSSSDSNGGDAEGPGP
PAPVTFQQICKDVHLVKHQGQQLFIESRARPCPRPRLPATGTFKAKTLPCQSPDLEVEAA
PAPSQVPPALAPEEAERKDASSCSYQQINCLDSILRYLESCNLPSTTKRKCASSSSCTAS
SASDDDKQRPGPVSMGAKKDPSAVLSGEGASPQKEPVVGGSLSPLALANKAESVVSVTSQ
CSFSSTIVHVGDKKPPESDIVMMEDLPGPPPGPAPSPTVAPDPAPDAYRPVGLTKAVLSL
HTQKEEQAFLSRFRDLGRLRGLDGSSTPPSAPGCPHGPAPPSRRHHCRSKAKRSRHHQTP
RAEAPCCVSHPSPVPSSAPWPPPPAATPFPAVVQPFPLPMFSPRGGPQPLPAAPTAVPPA
PFSAPLVTPMVALVLPNYLFPNPSSYPYGVAQAPAEGPPTPASHSPAPSLPPLPPSPPHR
PDSPLFNSRCSSPLQLNLLQLEEPPRVEAGAGAGGPGSSAGPPAPSQEAAEPEARLVEVT
ESSNQDALSGSSDLLELLLQEDSRSGTGSAASGSLGSALGSGSGSGSHEGGSTSASITRS
SQSSHTSKYFGSIDSSEAEAGAAQARAEPGDQVIKYVLQDPIWLLMANADQRVMMTYQVP
SRDMASVLKQDRERLRAMQKQQPRFSEDQRRELGAVHSWVRKGQLPRALDVMACVDCGSS
TQDPGHPDDPLFSEMDGLGLEPMEEGGGEGGEGEGGNEARAQAGAGASSSQDLAMEEEEQ
GGSSSSPALPATEDGTN
Download sequence
Identical sequences ENSSSCP00000028676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]