SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000028691 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000028691
Domain Number 1 Region: 98-286,572-722
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.48e-111
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.000000683
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000028691   Gene: ENSSSCG00000012273   Transcript: ENSSSCT00000034750
Sequence length 756
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:46746253:46760489:-1 gene:ENSSSCG00000012273 transcript:ENSSSCT00000034750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTAHTAQFSHTDSLDLVLHTAREQFLVSPQEETRLWIKNAEGSFERLCNTHVTVLDAAL
KTGQVVIMETRNKDGTWPSAQPHAMNSATEEEEDFQGQPGICGLTNLGNTCFMNSALQCL
SNVPQLTEYFLKNRYLEELNFCNPLGMKGEIAEAYADLVKQAWSGHHRSIVPHVFKTKVG
HFASQFLGYQQHDSQELLSFLLDGLHEDLNRVKKKEYVELCDAAGRPDQEVAQEAWQNHK
RRNDSVIVDTFHGLFKSTLVCPDCGNVSVTFDPFCYLSVPLPVSHKRVMEVFFVSMDPRR
KPEQHRLVVPKKGKISDLCVALAKHTGVSPERMMVADVFSHRFYKIYQLEESLSSILDRD
DIFIYEVSGRAAIGENSREDVVLPIYLRERTPARDYNNSYYGLMLFGHPLLVSVPRDRLS
WDALYHILLYRLSRYVTRPSSDDEDDGDEKDLEDKDTLPKPGHVAGSSSQDPGLEQAGPS
SGVAGGSRAPVDNSPGPSHWPQRARRKHLFTLQTVNSNGTSDRSTFNEDTHAQPYIAIDW
EPEMKKRYYDEVEAEGYVKHDCVGYVLKKAPVRLQECIELFTTVETLEKENPWYCPTCKQ
HQLATKKLDLWMLPETLIIHLKRFSYTKFSREKLDTLVEFPIRDLDFSEFVIKPQNESAP
ELYKYDLIAVSNHYGGLRDGHYTTFACNKDSGQWHYFDDNSVSPVTENQIESKAAYVLFY
QRQDVARRLQPQPGFSERPASPACGIPPSSEFMDVN
Download sequence
Identical sequences K7GLG2
ENSSSCP00000028691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]