SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000028697 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000028697
Domain Number - Region: 120-154
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000162
Family SPRY domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000028697   Gene: ENSSSCG00000014672   Transcript: ENSSSCT00000035029
Sequence length 237
Comment pep:putative chromosome:Sscrofa10.2:9:4691934:4696606:1 gene:ENSSSCG00000014672 transcript:ENSSSCT00000035029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QMEPERHRIQKQFDQLRSILDKEEQRQLRKLEEEERKGLSVIAEAEGELLQQSQSLRELI
SDLERRCQGSMTELLQDVRDVAERSEFWTLKKPEALPTKLKSVFRAPDLKKMLRVFRELT
DVQSYWVDVTLNPHTANLNLVLSKNRRQPVCRRSERLLQIPTSERILGDWITPEARIQGL
RGLVCLAAALHDCASPPGGRVPRLRGRHGLLLQRHQPWLPHLHLLQILLPLHSLSVF
Download sequence
Identical sequences ENSSSCP00000028697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]