SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000028758 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000028758
Domain Number 1 Region: 129-190
Classification Level Classification E-value
Superfamily HSP20-like chaperones 0.000000837
Family HSP20 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000028758   Gene: ENSSSCG00000006056   Transcript: ENSSSCT00000036682
Sequence length 195
Comment pep:novel chromosome:Sscrofa10.2:4:37337469:37346726:-1 gene:ENSSSCG00000006056 transcript:ENSSSCT00000036682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALSCLLDSVRRDIKKVDRELRQLRCIDEFSTRCLCDLYMHPYCCCDLHPYPYCLCYSK
RSRSCGLCDLYPCCLCDVKLYCLRPSLRSLERKAIRAIEDEKRELAKLRRTTNRILASSC
CSSNILGSVNVCGFEPDQVKVRVKDGKVCVSAERENRYDCLGSKKYSYMNICKEFSLPPC
VDEKDVTYSYGLGSC
Download sequence
Identical sequences ENSSSCP00000028758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]