SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000028983 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000028983
Domain Number 1 Region: 2-149
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.08e-46
Family Calpain large subunit, catalytic domain (domain II) 0.0000415
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000028983   Gene: ENSSSCG00000012584   Transcript: ENSSSCT00000034962
Sequence length 164
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:105674632:105696149:-1 gene:ENSSSCG00000012584 transcript:ENSSSCT00000034962 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
IRDGRLFCDPTFLPENDSLFYNRLLPGKVVWKRPQDICDDPRLIVGNISNHQLIQGRLGH
KPMVSAFSCLAVQESHWTKTIPNHKEQEWDPRKLDKYAGIFHFRFWHFGEWTEVVIDDLL
PTINGDLVFSFSTSMNEFWNALLEKAYANHLIRRNKKLKLIGVY
Download sequence
Identical sequences ENSSSCP00000028983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]