SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029029 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000029029
Domain Number 1 Region: 103-283
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-66
Family SPRY domain 0.0000071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029029   Gene: ENSSSCG00000030874   Transcript: ENSSSCT00000035452
Sequence length 292
Comment pep:novel chromosome:Sscrofa10.2:7:28767361:28796598:-1 gene:ENSSSCG00000030874 transcript:ENSSSCT00000035452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTYPRDCCRKLPIMNENHKESQPKVDHVDDNFATCLLKLLVMVLIFYVFREECFGNKKR
KGNDQLKENDQLRKENGKLQKEIDERKAQFRNGWQKSLLYPDWRKEFFQAVTITLDPDTA
HPSLVLSEGNRRVTWGEKSQDLPENPQRFYSFPCVLGLQVITSGRCYWEVEVGDSQAWDL
GICRSHVMRKGGISIKPEGGFWAIRSYNDEYWALTSPETQLIPKEHPARVCIFLEYEEGR
ISFYNMTDKSHIHTFSQGSFEGPLKPFFRLWPSDSACLTICPVLEAAQNPLC
Download sequence
Identical sequences XP_020954142.1.46622 ENSSSCP00000029029 ENSSSCP00000029029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]