SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029118 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000029118
Domain Number 1 Region: 32-132
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000421
Family V set domains (antibody variable domain-like) 0.06
Further Details:      
 
Domain Number 2 Region: 110-150
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000169
Family Fibronectin type III 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029118   Gene: ENSSSCG00000010968   Transcript: ENSSSCT00000036246
Sequence length 160
Comment pep:known_by_projection chromosome:Sscrofa10.2:10:36284037:36289170:-1 gene:ENSSSCG00000010968 transcript:ENSSSCT00000036246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSCSGLSRVLVAVAAALVSASSPCPQAWGPPGVQYGQPGRSMTLCCPGVTAGAPVSWF
RDGETRLLQGPDSGLGHELVLARAESTDEGTYICRTLDGALGGMVTLQLGYPPARPVVSC
RAADYENFSCTWSPSQVSGLPTRYLTSYRKKTVPGADGQR
Download sequence
Identical sequences ENSSSCP00000029118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]