SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029159 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000029159
Domain Number 1 Region: 15-100
Classification Level Classification E-value
Superfamily Immunoglobulin 5.65e-16
Family C1 set domains (antibody constant domain-like) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029159   Gene: ENSSSCG00000003226   Transcript: ENSSSCT00000034793
Sequence length 106
Comment pep:novel chromosome:Sscrofa10.2:6:51581792:51582697:1 gene:ENSSSCG00000003226 transcript:ENSSSCT00000034793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XPLLLLLPLLWAALTQAPYILMPETLESGRPRRLTCSVPWACERGTPPVFSWASAALPAL
GPRTPLSSVVTLTPRPQDHGTSLTCQVMFPASGVTVGRTIQLNVTC
Download sequence
Identical sequences ENSSSCP00000029159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]