SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029194 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000029194
Domain Number - Region: 96-132
Classification Level Classification E-value
Superfamily FKBP-like 0.0576
Family FKBP immunophilin/proline isomerase 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029194   Gene: ENSSSCG00000001431   Transcript: ENSSSCT00000034820
Sequence length 137
Comment pep:known chromosome:Sscrofa10.2:7:27993704:27995331:-1 gene:ENSSSCG00000001431 transcript:ENSSSCT00000034820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METPPVSPLGEKNISQPQQRWKKNSQKILDSTTQIRQQPQDPSTELLEGRVSPDPAGQIL
ENLQEIEKLAVGREGDSDKSHGPASEMPEPLQASELWYCPDGSFVKKILIHGHGLDKPKL
GSRCRVQVLGFPLGSGL
Download sequence
Identical sequences A5A8W2
ENSSSCP00000029194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]