SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029201 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000029201
Domain Number 1 Region: 28-160
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 1.81e-17
Family 4HBT-like 0.012
Further Details:      
 
Domain Number 2 Region: 202-248
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 0.0000281
Family 4HBT-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029201   Gene: ENSSSCG00000012172   Transcript: ENSSSCT00000036044
Sequence length 249
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:21207373:21222133:-1 gene:ENSSSCG00000012172 transcript:ENSSSCT00000036044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XDHVKAMEERKLLSSFLAESQKALPSRRMKDSYTEVLLPLGSQPELREKYLTVQNTVRFG
RILEDLDSLGDMCKKSLSPEQDIKFSGHVSWVGKTSMEVKMQMFQLHDNEFFPVLSATFV
MVARDSENKRPAFVNPLILESPEEEELFRQGELNKGRRVAFSSASLLKMAPTAEERTTIH
DMFLSTLDPKTISFRSRVLPPNGVWMESSKLKSLDICHPQERNIFNRIFGGFLMRRAYEL
GWATACNFG
Download sequence
Identical sequences ENSSSCP00000029201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]