SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029291 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000029291
Domain Number 1 Region: 49-462
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 9.29e-99
Family Iron-containing alcohol dehydrogenase 0.0000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029291   Gene: ENSSSCG00000006213   Transcript: ENSSSCT00000034369
Sequence length 467
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:74419651:74452853:-1 gene:ENSSSCG00000006213 transcript:ENSSSCT00000034369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAARARVAHLLRQLQRAACQCPSHSHTYSQAPGFSPSGKTTDYAFEMAVSNIRYGAGV
TKEVGMDLQNMGATNVCLMTDKNLSQLPPVQTVMDSLVKNGINFKVYDNVRVEPTQRSFM
EAIEFAKKGAFDAYVAVGGGSTMDTCKAANLYASSPHSEFLDYVSAPIGKGKPVTVPLKP
LIAVPTTSGTGSETTGVAVFDYEHLKVKTGIASRAIKPTLGLIDPLHTRHMPDGVVANSG
FDVLCHALESYTALPYHMRSPCPSSPIARPAYQGSNPISDIWAVHALRIVAKYLKRAVRN
PDDVEARSNMHLASAFAGIGFGNAGVHLCHGMSYPISGLVKTYRAKDYNVDHPLVPHGLS
VVLTSPAVFTFTAQMSPERHLETAGILGADIRTARTPDAGPILADTLRKFLFDLDVDDGL
AALGYSKADIPALVKGTLPQERVTKLAPRPQSEEDLSALFEASMKLY
Download sequence
Identical sequences F1RTZ1
9823.ENSSSCP00000006624 XP_003125651.1.46622 ENSSSCP00000029291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]